Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSFY1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$482.50
Specifications
Antigen | HSFY1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180129
|
Novus Biologicals
NBP180129 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
HSFY1 Polyclonal specifically detects HSFY1 in Human samples. It is validated for Western Blot.Specifications
HSFY1 | |
Polyclonal | |
Purified | |
RUO | |
FLJ25453, Heat shock transcription factor 2-like protein, heat shock transcription factor, Y linked 2, heat shock transcription factor, Y-linked, HSF2L, HSF2-like, HSFY, HSFY1 | |
HSFY1 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
Q96LI6 | |
86614 | |
Synthetic peptide directed towards the N terminal of human HSFY1 (NP_149099). Peptide sequence SWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNLYGFSKI. | |
Primary | |
45 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title