Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Hsp70 interacting protein HIP Mouse anti-Human, Clone: CL3708, Novus Biologicals™

Mouse Monoclonal Antibody

Manufacturer:  Novus Biologicals NBP261615

Catalog No. NBP261615


Add to cart

Description

Description

Hsp70 interacting protein HIP Monoclonal antibody specifically detects Hsp70 interacting protein HIP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

Hsp70 interacting protein HIP
CL3708
Western Blot 1 ug/ml, Immunohistochemistry 1:10000 - 1:20000
Purified
ST13
This antibody was developed against a recombinant protein corresponding to amino acids: EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA
Protein A purified
Membrane Trafficking and Chaperones
Primary
6767
Human
Immunohistochemistry, Western Blot
Unconjugated
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
AAG2, aging-associated protein 2, FAM10A1FAM10A4, heat shock 70kD protein binding protein, Hip, HIPFLJ27260, HOP, hsc70-interacting protein, Hsp70-interacting protein, HSPABP1, P48MGC129952, PRO0786, Progesterone receptor-associated p48 protein, Protein FAM10A1, Putative tumor suppressor ST13, Renal carcinoma antigen NY-REN-33, SNC6HSPABP, suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein), suppression of tumorigenicity 13 (colon carcinoma) (Hsp70-interacting protein), Suppression of tumorigenicity 13 protein
Mouse
IgG1
100 ul
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Monoclonal
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit