HspA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154348

Catalog No. NBP154348

Description

HspA4 Polyclonal specifically detects HspA4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HspA4
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P34932
• Gene Symbols: HSPA4
• Immunogen: Synthetic peptides corresponding to HSPA4(heat shock 70kDa protein 4) The peptide sequence was selected from the middle region of HSPA4. Peptide sequence PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: APG2, APG-2, heat shock 70 kDa protein 4, heat shock 70kD protein 4, heat shock 70kDa protein 4, Heat shock 70-related protein APG-2, heat shock protein, 110 kDa, HS24/P52, hsp70, hsp70RY, MGC131852, RY
• Host Species: Rabbit
• Molecular Weight of Antigen: 94 kDa
• Quantity: 100 μL
• Research Discipline: Cancer, Hypoxia, Membrane Trafficking and Chaperones
• Gene ID (Entrez): 3308
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG