Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HspA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP154348

 View more versions of this product

Catalog No. NBP154348


Add to cart

Description

Description

HspA4 Polyclonal antibody specifically detects HspA4 in Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish samples. It is validated for Western Blot.
Specifications

Specifications

HspA4
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
HSPA4
Synthetic peptides corresponding to HSPA4(heat shock 70kDa protein 4) The peptide sequence was selected from the middle region of HSPA4. Peptide sequence PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK.
94 kDa
100 ul
Cancer, Hypoxia, Membrane Trafficking and Chaperones
Primary
3308
Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Western Blot
Western Blot 1:100-1:2000
P34932
APG2, APG-2, heat shock 70 kDa protein 4, heat shock 70kD protein 4, heat shock 70kDa protein 4, Heat shock 70-related protein APG-2, heat shock protein, 110 kDa, HS24/P52, hsp70, hsp70RY, MGC131852, RY
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit