Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HspA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen HspA4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP154348
View Documents
Novus Biologicals
NBP154348
100 μL
Each for $436.00
Add to cart
 
NBP15434820
View Documents
Novus Biologicals
NBP15434820UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

HspA4 Polyclonal specifically detects HspA4 in Human samples. It is validated for Western Blot.
Specifications

Specifications

HspA4
Polyclonal
Rabbit
Cancer, Hypoxia, Membrane Trafficking and Chaperones
P34932
3308
Synthetic peptides corresponding to HSPA4(heat shock 70kDa protein 4) The peptide sequence was selected from the middle region of HSPA4. Peptide sequence PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
APG2, APG-2, heat shock 70 kDa protein 4, heat shock 70kD protein 4, heat shock 70kDa protein 4, Heat shock 70-related protein APG-2, heat shock protein, 110 kDa, HS24/P52, hsp70, hsp70RY, MGC131852, RY
HSPA4
IgG
Affinity Purified
94 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit