Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HspA4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HspA4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154348
|
Novus Biologicals
NBP154348 |
100 μL |
Each for $436.00
|
|
NBP15434820
|
Novus Biologicals
NBP15434820UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
HspA4 Polyclonal specifically detects HspA4 in Human samples. It is validated for Western Blot.Specifications
| HspA4 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Hypoxia, Membrane Trafficking and Chaperones | |
| P34932 | |
| 3308 | |
| Synthetic peptides corresponding to HSPA4(heat shock 70kDa protein 4) The peptide sequence was selected from the middle region of HSPA4. Peptide sequence PIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| APG2, APG-2, heat shock 70 kDa protein 4, heat shock 70kD protein 4, heat shock 70kDa protein 4, Heat shock 70-related protein APG-2, heat shock protein, 110 kDa, HS24/P52, hsp70, hsp70RY, MGC131852, RY | |
| HSPA4 | |
| IgG | |
| Affinity Purified | |
| 94 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title