Invitrogen™ HSPA9 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579410

Catalog No. PIPA579410

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human A549 whole cell, human Jurkat whole cell, human HepG2 whole cell, rat testis tissue, rat PC-12 whole cell, mouse testis tissue, mouse NIH/3T3 whole cell. IHC: human lung cancer tissue, human intestinal cancer tissue. ICC/IF: A549 cell. Flow: HL-60 cell IP: HepG2 cell.

The HSP70 family is composed of four highly conserved proteins: HSP70, HSC70, GRP75 and GRP78. These proteins serve a variety of roles. GRP75 expression is restricted to the mitochondrial matrix and aids in the translocation and folding of nascent polypeptide chains of both nuclear and mitochondrial origin. GRP75 and GRP78 are unresponsive to heat stress and are induced by glucose deprivation.

Specifications

• Antigen: HSPA9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: HSPA9
• Gene Alias: 70 kDa heat shock protein; 74kDa; 75 kDa glucose-regulated protein; C3H-specific antigen; catecholamine-regulated protein 40; CRP40; CSA; epididymis secretory sperm binding protein Li 124m; EVPLS; GRP 75; GRP75; GRP-75; heat shock 70 kDa protein 9; heat shock 70 kDa protein 9B; heat shock 70kD protein 9B; heat shock 70kDa protein 9 (mortalin); heat shock 70kDa protein 9A; heat shock 70kDa protein 9B (mortalin-2); Heat shock protein; heat shock protein 9; heat shock protein 9A; heat shock protein cognate 74; heat shock protein family A (Hsp70) member 9; heat shock protein family A (Hsp70) member 9 S homeolog; heat shock protein, 74 kDa, A; heat shock protein, A; HEL-S-124m; Hsc74; HSP; Hsp74; Hsp74a; hspa9; hspa9.S; Hspa9a; hspa9-a; hspa9b; hspa9-b; hypothetical protein; I79_009139; MGC4500; mortalin; mortalin, perinuclear; mortalin2; mortalin-2; mot; MOT2; Mot-2; Mthsp70; mt-HSP70; MTHSP75; p66 MOT; p66-mortalin; pbp74; Peptide-binding protein 74; RCJMB04_2m8; SAAN; SIDBA4; stress-70 protein mitochondrial-like protein; stress-70 protein, mitochondrial; Stress-70 protein, mitochondrial-like protein; XELAEV_18020021mg
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 15526, 291671, 3313
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Immunoprecipitation, Western Blot, Immunocytochemistry
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P38646, P38647, P48721
• Gene Symbols: HSPA9
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat, Monkey
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov