HspBAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180027

Catalog No. NBP180027

Description

HspBAP1 Polyclonal specifically detects HspBAP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: HspBAP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ22623, heat shock 27 kDa associated protein, HSPB (heat shock 27kD) associated protein 1, HSPB (heat shock 27kDa) associated protein 1, HSPB1-associated protein 1,27 kDa heat shock protein-associated protein 1, PASS1FLJ39386, Protein associated with small stress protein 1, protein associating with small stress protein PASS1
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_078886
• Gene Symbols: HSPBAP1
• Immunogen: Synthetic peptide directed towards the middle region of human HSPBAP1. Peptide sequence GCNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79663
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG