Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

HspBAP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen HspBAP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180027
View Documents
Novus Biologicals
NBP180027
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

HspBAP1 Polyclonal specifically detects HspBAP1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

HspBAP1
Polyclonal
Rabbit
NP_078886
79663
Synthetic peptide directed towards the middle region of human HSPBAP1. Peptide sequence GCNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNPDLKR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
FLJ22623, heat shock 27 kDa associated protein, HSPB (heat shock 27kD) associated protein 1, HSPB (heat shock 27kDa) associated protein 1, HSPB1-associated protein 1,27 kDa heat shock protein-associated protein 1, PASS1FLJ39386, Protein associated with small stress protein 1, protein associating with small stress protein PASS1
HSPBAP1
IgG
Affinity Purified
55 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit