Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
HSU79274 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | HSU79274 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156675
|
Novus Biologicals
NBP156675 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
HSU79274 Polyclonal specifically detects HSU79274 in Human samples. It is validated for Western Blot.Specifications
| HSU79274 | |
| Polyclonal | |
| Rabbit | |
| Stem Cell Markers | |
| Q8WUB2 | |
| 29902 | |
| Synthetic peptides corresponding to C12ORF24 The peptide sequence was selected from the N terminal of C12ORF24. Peptide sequence AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 12 open reading frame 24, HSU79274, hypothetical protein LOC29902, protein predicted by clone 23733 | |
| FAM216A | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title