Abnova™ Human AATF Partial ORF (AAH00591, 151 a.a. - 250 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00026574Q01L

Catalog No. 89-932-086

Description

The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq]

Sequence: VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT

Specifications

• Accession Number: AAH00591
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 36.63kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: VQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLT
• Regulatory Status: RUO
• Common Name: AATF
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 26574
• Name: AATF (Human) Recombinant Protein (Q01)
• Quantity: 25 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CHE-1/CHE1/DED
• Gene Symbol: AATF
• Recombinant: Recombinant
• Expression System: wheat germ expression system