Abnova™ Human ADAMTS1 (253 a.a. - 617 a.a.) amino acids 618-968 deleted Partial Recombinant Protein with His tag expressed in insect cells

Used for Func, SDS-PAGE

Supplier:  Abnova™ P4930

Catalog No. 89-932-578

Description

This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motif) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two disintegrin loops and three C-terminal TS motifs and has anti-angiogenic activity. The expression of this gene may be associated with various inflammatory processes as well as development of cancer cachexia. This gene is likely to be necessary for normal growth, fertility, and organ morphology and function. [provided by RefSeq]

Sequence: FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPHNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHGNWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLEDCPDN

Specifications

• Accession Number: Q9UHI8
• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 9510
• Name: ADAMTS1 (d618-968) (Human) Recombinant Protein
• Quality Control Testing: 15% SDS-PAGE Stained with Coomassie Blue
• Immunogen: FVSSHRYVETMLVADQSMAEFHGSGLKHYLLTLFSVAARLYKHPSIRNSVSLVVVKILVIHDEQKGPEVTSNAALTLRNFCNWQKQHNPPSDRDAEHYDTAILFTRQDLCGSQTCDTLGMADVGTVCDPSRSCSVIEDDGLQAAFTTAHELGHVFNMPHDDAKQCASLNGVNQDSHMMASMLSNLDHSQPWSPCSAYMITSFLDNGHGECLMDKPHNPIQLPGDLPGTSYDANRQCQFTFGEDSKHCPDAASTCSTLWCTGTSGGVLVCQTKHFPWADGTSCGEGKWCINGKCVNKTDRKHFDTPFHGNWGMWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNLEDCPDN
• Regulatory Status: RUO
• Common Name: ADAMTS1
• Biological Activity: ≥ 1.4mU/mg
• Recombinant: Recombinant
• Expression System: Insect cell expression system
• Purity or Quality Grade: >90% by SDS-PAGE

• Concentration: 0.2 mg/mL
• Formulation: Liquid
• Molecular Weight (g/mol): 41kDa
• Preparation Method: Insect cell expression system
• Quantity: 5 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: C3-C5/KIAA1346/METH1
• Gene Symbol: ADAMTS1
• Species: Baculovirus
• Protein Tag: His
• Form: Liquid