Abnova™ Human AGPAT3 Full-length ORF (AAH04219.1, 1 a.a. - 63 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00056894P02S

Catalog No. 89-932-836

Description

The protein encoded by this gene is an acyltransferase that converts lysophosphatidic acid into phosphatidic acid, which is the second step in the de novo phospholipid biosynthetic pathway. The encoded protein may be an integral membrane protein. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: MGSPAHLPKDAIAVFIVFPRVRHWLSGTRRQCTRRAPYVRCFKVPVLRKRSLVEEMSAEQITK

Specifications

• Accession Number: AAH04219.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 33.7kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 10 ug
• Regulatory Status: RUO
• Common Name: AGPAT3
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 56894
• Name: AGPAT3 (Human) Recombinant Protein (P02)
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: LPAAT-GAMMA1/MGC4604
• Gene Symbol: AGPAT3
• Recombinant: Recombinant
• Expression System: wheat germ expression system