Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human AHSG (P02765) Partial Recombinant Protein expressed in HEK293 cells

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P5981

Catalog No. 89-932-923


Add to cart

Description

Description

Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure. [provided by RefSeq]

Sequence: A-Chain:
Specifications

Specifications

Mammalian cell (HEK293) expression system
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
45-55kDa
Mammalian cell (HEK293) expression system
50 ug
Store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1ng/μg of protein (<1 EU/μg).
AHSG
Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Human ;Human
Yes
P02765
Lyophilized
197
AHSG (Human) Recombinant Protein
0.98
A-Chain: APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL B-Chain: TVVQPSVGAAAGPVVPPCPGRIRHFKV
RUO
A2HS/AHS/FETUA/HSGA
AHSG
Determined by its ability to inhibit Cathespin V cleavage of a fluorogenic peptide substrate Z-LR-AMC (RLUs). The expected IC50 is ≤ 100nM.
Human
None
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit