Abnova™ Human ALDH1L1 Partial ORF (NP_036322, 803 a.a. - 902 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00010840Q01S

Catalog No. 89-933-097

Description

The protein encoded by this gene catalyzes the conversion of 10-formyltetrahydrofolate, NADP, and water to tetrahydrofolate, NADPH, and carbon dioxide. The encoded protein belongs to the aldehyde dehydrogenase family and is responsible for formate oxidation in vivo. Deficiencies in this gene can result in an accumulation of formate and subsequent methanol poisoning. [provided by RefSeq]

Sequence: EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY

Specifications

• Accession Number: NP_036322
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 36.74kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: EESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
• Regulatory Status: RUO
• Common Name: ALDH1L1
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 10840
• Name: ALDH1L1 (Human) Recombinant Protein (Q01)
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: DKFZp781N0997/FTHFD
• Gene Symbol: ALDH1L1
• Recombinant: Recombinant
• Expression System: wheat germ expression system