Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human ANAPC13 (NP_056206, 1 a.a. - 74 a.a.? ) Full-length Recombinant Protein with His tag

Used for SDS-PAGE

Manufacturer:  Abnova™ P5847

Catalog No. 89-933-356


Add to cart

Description

Description

This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined. [provided by RefSeq]

Sequence: MASMTGGQQMGRGSHMDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN
Specifications

Specifications

Escherichia coli expression system
Liquid
25847
ANAPC13 (Human) Recombinant Protein
>90% by SDS - PAGE
50 ug
RUO
ANAPC13
Escherichia coli
His
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
In 20mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1mM DTT, 0.1M NaCl).
10kDa
Escherichia coli expression system
3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
APC13/DKFZp566D193/SWM1
ANAPC13
Yes
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit