Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human APOE (E4) (P02649) Partial Recombinant Protein

Used for SDS-PAGE

Manufacturer:  Abnova™ P5945

Catalog No. 89-935-356


Add to cart

Description

Description

Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. [provided by RefSeq]

Sequence: MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
Specifications

Specifications

Escherichia coli expression system
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
34.4kDa
Escherichia coli expression system
100 ug
Store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1ng/μg of protein (<1 EU/μg).
APOE
Tissue dissociation (combined with other enzymes); Cell harvesting by trypsinization; Mitochondria isolation; in vitro studies of proteins; Various hemagglutination procedures; Sample preparation for flow cytometric DNA analysis; Tryptic mapping; Fingerprinting and sequencing work; Environmental monitoring; Subculturing cells; Cleavage fusion proteins; Generating glycopeptides from purified glycoproteins.
Escherichia coli
None
P02649
Lyophilized
348
APOE (E4) (Human) Recombinant Protein
0.9
MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVRGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
RUO
AD2/LPG/MGC1571/apoprotein
APOE
Human ;Human
Yes
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit