Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human ATOX1 (NP_004036, 1 a.a. - 68 a.a.) Full-length Recombinant Protein with His tag

Used for SDS-PAGE

Manufacturer:  Abnova™ P3546

Catalog No. 89-935-983


Add to cart

Description

Description

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Specifications

Specifications

Escherichia coli expression system
1 mg/mL
Liquid
475
ATOX1 (Human) Recombinant Protein
Conventional Chromatography
Loading 3 ug protein in 15% SDS-PAGE
Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
ATX1/HAH1/MGC138453/MGC138455
ATOX1
Yes
NP_004036
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
In 20mM Tris-HCl, pH 8.0 (1mM dithiothreitol, 10% glycerol)
9.5kDa
Escherichia coli expression system
>95% by SDS-PAGE
100 ug
RUO
ATOX1
Escherichia coli
His
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit