Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CACNG7 Partial ORF (NP_114102.2, 203 a.a. - 274 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00059284Q01L

 View more versions of this product

Catalog No. 89-937-810


Add to cart

Description

Description

The mouse protein stargazin is one of five subunits comprising neuronal voltage-gated calcium channels. This subunit, gamma, is thought to stabilize the calcium channel in an inactive (closed) state. Mutations in the gene encoding stargazin have been associated with absence seizures, also known as petit-mal or spike-wave seizures. The protein encoded by this gene is structurally similar to the mouse stargazin protein and is a member of the neuronal calcium channel gamma subunit protein family. However, it appears unlikely that the encoded protein is part of a functional calcium channel. Rather, it appears to inhibit the expression of a specific calcium channel subunit. [provided by RefSeq]

Sequence: RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP
Specifications

Specifications

wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
33.66kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSP
RUO
CACNG7
Yes
NP_114102.2
Liquid
59284
CACNG7 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CACNG7
Wheat Germ (in vitro)
GST
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit