Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CARD8 Partial ORF (NP_055774, 322 a.a. - 431 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00022900Q01L

 View more versions of this product

Catalog No. 89-938-028


Add to cart

Description

Description

The protein encoded by this gene belongs to the caspase recruitment domain (CARD)-containing family of proteins, which are involved in pathways leading to activation of caspases or nuclear factor kappa-B (NFKB). This protein may be a component of the inflammasome, a protein complex that plays a role in the activation of proinflammatory caspases. It is thought that this protein acts as an adaptor molecule that negatively regulates NFKB activation, CASP1-dependent IL1B secretion, and apoptosis. Polymorphisms in this gene may be associated with a susceptibility to rheumatoid arthritis. Alternatively spliced transcript variants have been described for this gene, but their biological validity has not been determined. [provided by RefSeq]

Sequence: WDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL
Specifications

Specifications

wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
WDTEVKPVDLQLVAASAPPPFSGAAFVKENHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDPYLVSYLRQQNL
RUO
CARD8
Wheat Germ (in vitro)
GST
NP_055774
Liquid
22900
CARD8 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CARDINAL/DACAR/DKFZp779L0366/Dakar/FLJ18119/FLJ18121/KIAA0955/MGC57162/NDPP/NDPP1/TUCAN
CARD8
Yes
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit