Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CCL25 (O15444) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P6162

Catalog No. 89-938-404


Add to cart

Description

Description

This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. [provided by RefSeq]

Sequence: QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSRKNVSLLISANSGL
Specifications

Specifications

Escherichia coli expression system
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
14.2kDa
Escherichia coli expression system
20 ug
Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
<0.1ng/μg of protein (<1 EU/μg).
CCL25
Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Human ;Human
Yes
O15444
Lyophilized
6370
CCL25 (Human) Recombinant protein
0.98
QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSRKNVSLLISANSGL
RUO
Ckb15/MGC150327/SCYA25/TECK
CCL25
Determined by its ability to chemoattrract human monocytes using a concentration range of 1.0-10.0ng/mL.
Escherichia coli
None
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit