Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CD74 Full-length ORF (NP_001020329.1) Recombinant Protein without tag

Used for AP, Func, Screening

Manufacturer:  Abnova™ H00000972G01

Catalog No. 89-938-766


Add to cart

Description

Description

Sequence: MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
Specifications

Specifications

wheat germ expression system with proprietary liposome technology
Antibody Production, Compound Screening, Functional Study
Liquid
18.3kDa
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
DHLAG/HLADG/Ia-GAMMA
CD74
Yes
NP_001020329.1
Liquid
972
CD74 (Human) Recombinant Protein
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
RUO
CD74
Wheat Germ (in vitro)
None
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit