Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Human Chac1 Full-Length Orf (Np_077016.1, 1 A.A.-222 A.A.) Recombinant Protein With Gst Tag At N-Terminal.
Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.
$448.00 - $677.00
Specifications
| Accession Number | NP_077016.1 |
|---|---|
| For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID (Entrez) | 79094 |
| Name | CHAC1 (Human) Recombinant Protein (P01) |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
89-032-147
|
Abnova™
H00079094P01S |
10 ug |
Each for $448.00
|
|
|||||
|
89-032-148
|
Abnova™
H00079094P01L |
25 ug |
Each for $677.00
|
|
|||||
Description
- Good Folding
- Excellent amino acids labeling
Immunogen Sequence: MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVAT
Specifications
| NP_077016.1 | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| CHAC1 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MGC4504 | |
| CHAC1 | |
| Liquid |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 79094 | |
| Glutathione Sepharose 4 Fast Flow | |
| MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV | |
| RUO | |
| CHAC1 | |
| GST |
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title