Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CLDN12 Full-length ORF (AAH36754.1, 1 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89939742
Click to view available options
Quantity:
10 μg
25 μg

Used for AP, Array, ELISA, WB-Re

Claudins, such as CLDN12, are components of epithelial cell tight junctions. Tight junctions regulate movement of solutes and ions through the paracellular space and prevent mixing of proteins and lipids in the outer leaflet of the apical and basolateral plasma membrane domains (Acharya et al., 2004).[supplied by OMIM]

Sequence: MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT

Specifications

Accession Number AAH36754.1
For Use With (Application) Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 9069
Molecular Weight (g/mol) 52.58kDa
Name Human CLDN12 Full-length ORF (AAH36754.1, 1 a.a. - 244 a.a.) Recombinant Protein with GST-tag at N-terminal
Purification Method Glutathione Sepharose 4 Fast Flow
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25 μg
Storage Requirements Store at −80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Common Name CLDN12
Gene Symbol CLDN12
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST Tag
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.