Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CLDN14 Partial ORF (NP_036262, 29 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

$460.50 - $709.50

Specifications

Name CLDN14 (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 31.57kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
89-939-744
View Documents
Abnova™
H00023562Q01L
25 ug
Each for $709.50
Add to cart
 
89-939-743
View Documents
Abnova™
H00023562Q01S
10 ug
Each for $460.50
Add to cart
 
Description

Description

Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. The encoded protein also binds specifically to the WW domain of Yes-associated protein. Defects in this gene are the cause of an autosomal recessive form of nonsyndromic sensorineural deafness. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPQDLQAAR
Specifications

Specifications

CLDN14 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
31.57kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit