Abnova™ Human CPNE5 Partial ORF (NP_065990, 393 a.a. - 450 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00057699Q01S

Catalog No. 89-940-367

Description

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Sequence analysis identified multiple alternatively spliced transcript variants but their full-length natures could not be determined. [provided by RefSeq]

Sequence: RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD

Specifications

• Accession Number: NP_065990
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 32.12kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue
• Immunogen: RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD
• Regulatory Status: RUO
• Common Name: CPNE5
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 57699
• Name: CPNE5 (Human) Recombinant Protein (Q01)
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: COPN5/CPN5/DKFZp666C234/KIAA1599
• Gene Symbol: CPNE5
• Recombinant: Recombinant
• Expression System: wheat germ expression system