Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CST9 (NP_001008693, 29 a.a. - 159 a.a.) Partial Recombinant Protein with His tag

Used for SDS-PAGE

Manufacturer:  Abnova™ P4321

Catalog No. 89-940-826


Add to cart

Description

Description

The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted protein that may play a role in hematopoietic differentiation or inflammation. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
Specifications

Specifications

NP_001008693
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Liquid
17.2kDa
Escherichia coli expression system
15% SDS-PAGE Stained with Coomassie Blue
MGSSHHHHHHSSGLVPRGSHMWCSEEEMGGNNKIVQDPMFLATVEFALNTFNVQSKEEHAYRLLRVLSSWREDSMDRKWRGKMVFSMNLQLRQTVCRKFEDDIDNCPFQESLELNNVRQGISFPQVHSCGCCMGCGVGTGAADKAIPRDKGK
RUO
CST9
Escherichia coli expression system
Yes
1 mg/mL
Liquid
128822
CST9 (Human) Recombinant Protein
>90% by SDS-PAGE
100 ug
Store at -20°C. For long term storage store at -80°C. Aliquot to avoid repeated freezing and thawing.
CLM
CST9
Escherichia coli
His
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit