Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human CX3CR1 Full-length ORF (NP_001328.1) Recombinant Protein without tag

Name: Abnova&trade; Human CX3CR1 Full-length ORF (NP_001328.1) Recombinant Protein without tag
Brand: Abnova&trade;
SKU: 89-941-022
Price: 978.00 USD

Used for AP, Func, Screening

Supplier: Abnova™ H00001524G01

Catalog No. 89-941-022

$978.00 / Each of 1

Qty

Add to Cart

Description

Sequence: MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL

Specifications

Accession Number	NP_001328.1
Formulation	Liquid
Molecular Weight (g/mol)	40.4kDa
Quantity	2 ug
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	CCRL1/CMKBRL1/CMKDR1/GPR13/GPRV28/V28
Gene Symbol	CX3CR1
Recombinant	Recombinant
Expression System	wheat germ expression system with proprietary liposome technology

For Use With (Application)	Antibody Production, Compound Screening, Functional Study
Gene ID (Entrez)	1524
Name	CX3CR1 (Human) Recombinant Protein
Immunogen	MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Regulatory Status	RUO
Common Name	CX3CR1
Species	Wheat Germ (in vitro)
Protein Tag	None
Form	Liquid

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

Abnova™ Human CX3CR1 Full-length ORF (NP_001328.1) Recombinant Protein without tag

Description

Specifications

Product Suggestions

Documents

Promotions