Abnova™ Human CXCL12 (beta) (P48061-1) Recombinant Protein

Used for Func, SDS-PAGE

Supplier:  Abnova™ P4566

Catalog No. 89-941-048

Description

For background information on chemokines, see CXCL1 (MIM 155730). Stromal cell-derived factors 1-alpha and 1-beta are small cytokines that belong to the intercrine family, members of which activate leukocytes and are often induced by proinflammatory stimuli such as lipopolysaccharide, TNF (see MIM 191160), or IL1 (see MIM 147760). The intercrines are characterized by the presence of 4 conserved cysteines which form 2 disulfide bonds. They can be classified into 2 subfamilies. In the CC subfamily, which includes beta chemokine, the cysteine residues are adjacent to each other. In the CXC subfamily, which includes alpha chemokine, they are separated by an intervening amino acid. The SDF1 proteins belong to the latter group.[supplied by OMIM]

Sequence: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM

Specifications

• Accession Number: P48061-1
• Formulation: Lyophilized
• Molecular Weight (g/mol): 8.5kDa
• Preparation Method: Escherichia coli expression system
• Quantity: 10 ug
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1 EU/μg
• Common Name: CXCL12
• Biological Activity: The activity is determined by the ability to chemoattract human peripheral T cells and is detectable starting at 5ng/mL.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 6387
• Name: CXCL12 (Beta) (Human) Recombinant Protein
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
• Immunogen: KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM
• Regulatory Status: RUO
• Gene Alias: PBSF/SCYB12/SDF-1a/SDF-1b/SDF1/SDF1A/SDF1B/TLSF-a/TLSF-b/TPAR1
• Gene Symbol: CXCL12
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized