Abnova™ Human CXCR4 Partial ORF (AAH20968, 1 a.a. - 46 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00007852Q01L

Catalog No. 89-941-103

Description

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]

Sequence: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

Specifications

• Accession Number: AAH20968
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 30.8kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
• Regulatory Status: RUO
• Common Name: CXCR4
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 7852
• Name: CXCR4 (Human) Recombinant Protein (Q01)
• Quantity: 25 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CD184/D2S201E/FB22/HM89/HSY3RR/LAP3/LCR1/LESTR/NPY3R/NPYR/NPYRL/NPYY3R/WHIM
• Gene Symbol: CXCR4
• Recombinant: Recombinant
• Expression System: wheat germ expression system