Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Human CXorf27 (NP_036406.1) Full-length Recombinant Protein in yeast
Used for SDS-PAGE
Supplier: Abnova™ P3794
Description
Sequence: MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKNDSpecifications
NP_036406.1 | |
Liquid | |
13kDa | |
Yeast expression system | |
100 ug | |
Store at -20°C. Aliquot to avoid repeated freezing and thawing. | |
1700054O13Rik/HIP17/HYPM | |
CXorf27 | |
Recombinant | |
Yeast expression system | |
0.9 |
SDS-PAGE | |
25763 | |
CXorf27 (Human) Recombinant Protein | |
Affinity Purification | |
MSEKKNCKNSSTNNNQTQDPSRNELQVPRSFVDRVVQDERDVQSQSSSTINTLLTLLDCLADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND | |
RUO | |
CXorf27 | |
Yeast | |
None | |
Liquid |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction