Abnova™ Human DHFR (NP_000782.1, 1 a.a. - 187 a.a.) Full-length Recombinant Protein with His tag

Used for Func, SDS-PAGE

Supplier:  Abnova™ P3492

Catalog No. 89-941-895

Description

Dihydrofolate reductase converts dihydrofolate into tetrahydrofolate, a methyl group shuttle required for the de novo synthesis of purines, thymidylic acid, and certain amino acids. While the functional dihydrofolate reductase gene has been mapped to chromosome 5, multiple intronless processed pseudogenes or dihydrofolate reductase-like genes have been identified on separate chromosomes. Dihydrofolate reductase deficiency has been linked to megaloblastic anemia. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND

Specifications

• Accession Number: NP_000782.1
• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 1719
• Name: DHFR (Human) Recombinant Protein
• Purification Method: Conventional Chromatography
• Quantity: 100 ug
• Storage Requirements: Store at 4°C. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Common Name: DHFR
• Biological Activity: Specific activity is 1.5-2.5 units/mL and was obtained by measuring the oxidation of NADPH in absorbance at 340nm during reaction. One unit will convert 1.0μmole of 7,8 dihydrofolate and beta-NADPH to 5,6,7,8-tetrahydrofolate and beta-NADP per minute at
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system
• Purity or Quality Grade: >95% by SDS-PAGE

• Concentration: 1 mg/mL
• Formulation: Liquid
• Molecular Weight (g/mol): 23.6kDa
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: Loading 3 ug protein in 15% SDS-PAGE
• Immunogen: MGSSHHHHHHSSGLVPRGSHMVGSLNCIVAVSQNMGIGKNGDLPWPPLRNEFRYFQRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEKGIKYKFEVYEKND
• Regulatory Status: RUO
• Gene Symbol: DHFR
• Species: E. coli
• Protein Tag: His
• Form: Liquid