Abnova™ Human DMTF1 Partial ORF (NP_066968, 661 a.a. - 760 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-942-151	Abnova™ H00009988Q01L	25 ug
89-942-150	Abnova™ H00009988Q01S	10 ug

Description

This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Sequence: KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH

Specifications

• Accession Number: NP_066968
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 36.74kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: DMP1/DMTF/FLJ25188/FLJ41265/FLJ76054/hDMP1
• Gene Symbol: DMTF1
• Recombinant: Recombinant
• Expression System: wheat germ expression system

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 9988
• Name: DMTF1 (Human) Recombinant Protein (Q01)
• Immunogen: KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
• Regulatory Status: RUO
• Common Name: DMTF1
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid