Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Human EBI3 Recombinant Protein
Used for Func, SDS-PAGE
Manufacturer: Abnova™ P4568
Description
This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq]
Sequence: MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGKSpecifications
| Q14213 | |
| Lyophilized | |
| 10148 | |
| EBI3 (Human) Recombinant Protein | |
| 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue | |
| MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK | |
| RUO | |
| IL27B | |
| EBI3 | |
| Escherichia coli | |
| None |
| Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis | |
| Lyophilized | |
| 23.3kDa | |
| Escherichia coli expression system | |
| 20 ug | |
| Store at -20°C. | |
| <0.1 EU/μg | |
| EBI3 | |
| Escherichia coli expression system | |
| Yes |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title