Abnova™ Human EDG1 Full-length ORF (NP_001391.2, 1 a.a. - 382 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00001901P01L

Catalog No. 89-942-758

Description

The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq]

Sequence: MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS

Specifications

• Accession Number: NP_001391.2
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 69.2kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quantity: 25μg
• Regulatory Status: RUO
• Common Name: EDG1
• Species: Wheat Germ (in vitro)
• Protein Tag: GST Tag
• Form: Liquid

• For Use With (Application): Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 1901
• Name: Human EDG1 Full-length ORF (NP_001391.2, 1 a.a. - 382 a.a.) Recombinant Protein with GST-tag at N-terminal
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, FLJ58121, S1P1
• Gene Symbol: S1PR1
• Recombinant: Recombinant
• Expression System: wheat germ expression system