Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human EIF4H (NP_001098751, 1 a.a. - 140 a.a.) Full-length Recombinant Protein with His tag

Used for SDS-PAGE

Manufacturer:  Abnova™ P5402

Catalog No. 89-943-096


Add to cart

Description

Description

This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq]

Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLS IRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNS GFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKE QE
Specifications

Specifications

NP_071496
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Liquid
29.9kDa
Escherichia coli expression system
Loading 3 ug protein in 15% SDS-PAGE
MGSSHHHHHHSSGLVPRGSHMGSHMADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLS IRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNS GFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKE QE
RUO
EIF4H
Escherichia coli expression system
Yes
0.5 mg/mL
Liquid
7458
EIF4H (Human) Recombinant Protein
Conventional Chromatography
100 ug
Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
KIAA0038|WBSCR1|WSCR1
EIF4H
Escherichia coli
His
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit