Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human FAM3D (NP_620160, 26 a.a. - 224 a.a.) Partial Recombinant Protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells

Used for SDS-PAGE

Manufacturer:  Abnova™ P5907

Catalog No. 89-943-956


Add to cart

Description

Description

Sequence: GSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVGAKDLRGKSPFEQKNSPDTNKYEGWPELLEMEGCMPPKPFAAAHHHHHH
Specifications

Specifications

NP_666162
Liquid
131177
FAM3D (Human) Recombinant Protein
NuPAGE Stained with Coomassie Blue
GSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVGAKDLRGKSPFEQKNSPDTNKYEGWPELLEMEGCMPPKPFAAAHHHHHH
RUO
FAM3D
Mammalian cell (HEK293EBNA1) expression system
Human
His
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Liquid
23.1kDa
Mammalian cell (HEK293EBNA1) expression system
100 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
EF7|OIT1
FAM3D
Human ;Human
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit