Learn More
Abnova™ Human FCAMR Partial ORF (NP_114418.1, 63 a.a. - 170 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Supplier: Abnova™ H00083953Q01
Description
This gene encodes a member of the immunoglobulin receptor gene family involved in the microbial immune response. The protein localizes to the cell surface, where it functions as a receptor for IgM and IgA antibodies. The mouse homolog of this protein can bind and internalize IgM-coated particles, and mediates endocytosis of IgM-coated Staphylococcus by primary B lymphocytes. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Sequence: TLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQLSPDDIGCSpecifications
NP_114418.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.62kDa | |
Glutathione Sepharose 4 Fast Flow | |
2 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
FCA/MR/FKSG87 | |
FCAMR | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
83953 | |
FCAMR (Human) Recombinant Protein (Q01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
TLRPSSPLCWREESSFAAPNSLKGSRLVSGEPGGAVTIQCHYAPSSVNRHQRKYWCRLGPPRWICQTIVSTNQYTHHRYRDRVALTDFPQRGLFVVRLSQLSPDDIGC | |
RUO | |
FCAMR | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.