Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human FDX1 (NP_004100, 61 a.a. - 184 a.a.) Partial Recombinant Protein

Used for SDS-PAGE

Manufacturer:  Abnova™ P3539

Catalog No. 89-944-364


Add to cart

Description

Description

The product of this gene is a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to a terminal cytochrome P450. This particular oxidation/reduction system is found in steroidogenic tissues, and is involved with the synthesis of bile acid and vitamin D. In addition to the expressed gene at this chromosomal locus (11q22), there are pseudogenes located on chromosomes 20 and 21. This gene product has been identified in a number of different tissues but all forms have been shown to be identical and are not tissue specific. [provided by RefSeq]

Sequence: MASMTGGQQMGRGSMSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
Specifications

Specifications

NP_004100
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Liquid
15kDa
Escherichia coli expression system
>90% by SDS-PAGE
100 ug
Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
<1.0 EU/μg of protein (determined by LAL method)
FDX1
Escherichia coli expression system
Yes
1 mg/mL
Liquid
2230
FDX1 (Human) Recombinant Protein
Conventional Chromatography
Loading 3 ug protein in 15% SDS-PAGE
MASMTGGQQMGRGSMSSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS
RUO
ADX|FDX|LOH11CR1D
FDX1
Escherichia coli
None
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit