Abnova™ Human FGF7 (P21781, 32 a.a. - 194 a.a.) Partial Recombinant Protein

Used for Func, SDS-PAGE

Supplier:  Abnova™ P3645

Catalog No. 89-944-489

Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq]

Sequence: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Specifications

• Accession Number: P21781
• Formulation: Lyophilized
• Molecular Weight (g/mol): 19kDa
• Preparation Method: Escherichia coli expression system
• Quantity: 10 ug
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Common Name: FGF7
• Biological Activity: The ED50 was determined by the dose-dependent proliferation of BAF3 cells was found to be less than 10ng/mL.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 2252
• Name: FGF7 (Human) Recombinant Protein
• Purification Method: Ion exchange column and HPLC reverse phase column
• Immunogen: CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
• Regulatory Status: RUO
• Gene Alias: HBGF-7/KGF
• Gene Symbol: FGF7
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized