Abnova™ Human FGF9 (P31371, 1 a.a. - 208 a.a.) Full-length Recombinant Protein

Used for Func, SDS-PAGE

Supplier:  Abnova™ P3608

Catalog No. 89-944-499

Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis. [provided by RefSeq]

Sequence: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Specifications

• Accession Number: P31371
• Formulation: Lyophilized
• Molecular Weight (g/mol): 23kDa
• Preparation Method: Escherichia coli expression system
• Quantity: 20 ug
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Common Name: FGF9
• Biological Activity: The ED50 was determined by the dose-dependent proliferationof BaF3 cells expressing FGF receptors and was found to be in the range of 0.6ng/mL.
• Recombinant: Recombinant
• Expression System: Escherichia coli expression system
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC

• For Use With (Application): Functional Study, SDS-PAGE
• Gene ID (Entrez): 2254
• Name: FGF9 (Human) Recombinant Protein
• Purification Method: Ion exchange column and HPLC reverse phase column
• Immunogen: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Regulatory Status: RUO
• Gene Alias: GAF/HBFG-9/MGC119914/MGC119915
• Gene Symbol: FGF9
• Species: E. coli
• Protein Tag: None
• Form: Lyophilized