Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human FHIT (NP_002003, 1 a.a. - 147 a.a.) Full-length Recombinant Protein with His tag

Used for SDS-PAGE

Manufacturer:  Abnova™ P3552

Catalog No. 89-944-564


Add to cart

Description

Description

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. [provided by RefSeq]

Sequence: MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQLEHHHHHH
Specifications

Specifications

NP_002003
Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Liquid
17.9kDa
Escherichia coli expression system
>95% by SDS-PAGE
100 ug
Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
AP3Aase|FRA3B
FHIT
Escherichia coli
His
1 mg/mL
Liquid
2272
FHIT (Human) Recombinant Protein
Conventional Chromatography
Loading 3 ug protein in 15% SDS-PAGE
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYFQLEHHHHHH
RUO
FHIT
Escherichia coli expression system
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit