Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human GABARAPL2 Partial ORF (NP_009216, 31 a.a. - 117 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

$464.00 - $716.00

Specifications

Accession Number NP_009216
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Format Liquid
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 11345
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
89-945-353
View Documents
Abnova™
H00011345Q01S
10 ug
Each for $464.00
Add to cart
 
89-945-354
View Documents
Abnova™
H00011345Q01L
25 ug
Each for $716.00
Add to cart
 
Description

Description

Sequence: VIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
Specifications

Specifications

NP_009216
Liquid
11345
GABARAPL2 (Human) Recombinant Protein (Q01)
VIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
RUO
GABARAPL2
Wheat Germ (in vitro)
GST
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.31kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ATG8/GATE-16/GATE16/GEF-2/GEF2
GABARAPL2
Yes
wheat germ expression system
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit