Abnova™ Human GYPA Full-length ORF (AAH13328.1, 1 a.a. - 150 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Catalog Number	Mfr. No.	Quantity
89-946-900	Abnova™ H00002993P01L	25μg
89-946-899	Abnova™ H00002993P01S	10μg

Description

Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. [provided by RefSeq]

Sequence: MYGKIIFVLLLSAIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ

Specifications

• Accession Number: AAH13328.1
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 42.7kDa
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: CD235a, GPA, GPErik, GPSAT, GpMiIII, HGpMiIII, HGpMiV, HGpMiX, HGpMiXI, HGpSta(C), MN, MNS
• Gene Symbol: GYPA
• Recombinant: Recombinant
• Expression System: wheat germ expression system

• For Use With (Application): Protein Array, ELISA, Western Blot
• Gene ID (Entrez): 2993
• Name: Human GYPA Full-length ORF (AAH13328.1, 1 a.a. - 150 a.a.) Recombinant Protein with GST-tag at N-terminal
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Regulatory Status: RUO
• Common Name: GYPA
• Species: Wheat Germ (in vitro)
• Protein Tag: GST Tag
• Form: Liquid