Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human HMGCS2 Partial ORF (NP_005509.1, 424 a.a. - 508 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00003158Q01S

 View more versions of this product

Catalog No. 89-947-637


Add to cart

Description

Description

Mitochondrial 3-hydroxy-3-methylglutaryl CoA synthase (HMGCS2; EC 2.3.3.10) mediates the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for brain, heart, kidney, and other organs during times of carbohydrate deprivation such as fasting (Robinson and Williamson, 1980 [PubMed 6986618]). Also see cytoplasmic HMG-CoA synthase (HMGCS1; MIM 142940), which mediates an early step in cholesterol synthesis.[supplied by OMIM]

Sequence: RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV
Specifications

Specifications

NP_005509.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.09kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV
RUO
HMGCS2
Yes
wheat germ expression system
Liquid
3158
HMGCS2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
HMGCS2
Wheat Germ (in vitro)
GST
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit