Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Abnova™ Human HSPC047 Full-length ORF (AAH35371.1, 1 a.a. - 160 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
$464.00 - $716.00
Specifications
Accession Number | AAH35371.1 |
---|---|
For Use With (Application) | Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) |
Format | Liquid |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 29060 |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
89-948-067
|
Abnova™
H00029060P01L |
25 ug |
Each for $716.00
|
|
89-948-066
|
Abnova™
H00029060P01S |
10 ug |
Each for $464.00
|
|
Description
Sequence: MRQEVEGRGRGSHELIITDKRCGVCGGSLSCIVYLCISLNFSRIKKLKKYTWPGPTRDSPNASLQPGRAKFAFSHASHTPLHSQLGELQTGKPQALLASANPLSRSMGPPDHHLTTLILISLYTPFPGLLSSGCFSLTLTLQLDHGGLGNRCLPRCWRYRSpecifications
AAH35371.1 | |
Liquid | |
29060 | |
HSPC047 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HSPC047 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
44kDa | |
Glutathione Sepharose 4 Fast Flow | |
MRQEVEGRGRGSHELIITDKRCGVCGGSLSCIVYLCISLNFSRIKKLKKYTWPGPTRDSPNASLQPGRAKFAFSHASHTPLHSQLGELQTGKPQALLASANPLSRSMGPPDHHLTTLILISLYTPFPGLLSSGCFSLTLTLQLDHGGLGNRCLPRCWRYR | |
RUO | |
NULL | |
Yes | |
wheat germ expression system |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title