Abnova™ Human IDH2 Partial ORF (NP_002159, 354 a.a. - 451 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Supplier:  Abnova™ H00003418Q01L

Catalog No. 89-948-236

Description

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. [provided by RefSeq]

Sequence: HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR

Specifications

• Accession Number: NP_002159
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight (g/mol): 36.52kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR
• Regulatory Status: RUO
• Common Name: IDH2
• Species: Wheat Germ (in vitro)
• Protein Tag: GST
• Form: Liquid

• For Use With (Application): Antibody Production, ELISA, Protein Array, Western Blot
• Gene ID (Entrez): 3418
• Name: IDH2 (Human) Recombinant Protein (Q01)
• Quantity: 25 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: ICD-M/IDH/IDHM/IDP/IDPM/mNADP-IDH
• Gene Symbol: IDH2
• Recombinant: Recombinant
• Expression System: wheat germ expression system