Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IFNA2 (P01563, 171 a.a.) Full-length Recombinant Protein with C-terminal His tag

Used for Func, SDS-PAGE, WB-Re

Manufacturer:  Abnova™ P5916

Catalog No. 89-948-348

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

Sequence: CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEHHHHHH
Specifications

Specifications

P01563
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis, Western Blot (Recombinant protein)
Lyophilized
20.1kDa
Non-transgenic plants (Nicotiana benthamiana) expression system
>97% by SDS-PAGE
10 ug
Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.04 EU/μg protein
IFNA2
The specific activity was determined by a quantitative gene reported bioassay using human Type I interferon-sensitive. The activity is < 8 x 108 units/mg in reference to a viral resistance assay using bovine kidney MDBK cells.
Plants
His
Non-transgenic plants (Nicotiana benthamiana) expression system
Lyophilized
3440
IFNA2 (Human) Recombinant Protein
Sequential chromatography (FPLC)
0.3 ug/lane in 15% SDS-polyacrylamide gel and stained with Coomassie blue
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEHHHHHH
RUO
IFNA|INFA2|MGC125764|MGC125765
IFNA2
Human ;Human
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit