Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IFNB1 (P01574) Partial Recombinant Protein expressed in CHO cells

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P6025

Catalog No. 89-948-381


Add to cart

Description

Description

Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
Specifications

Specifications

P01574
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
22.3kDa
Mammalian cell (CHO) expression system
20 ug
Store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.1ng/μg (<1 EU/μg).
IFNB1
Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Human ;Human
Yes
Mammalian cell (CHO) expression system
Lyophilized
3456
IFNB1 (Human) Recombinant Protein
0.95
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
RUO
IFB|IFF|IFNB|MGC96956
IFNB1
Assay 1:
Measured by its ability to induce apoptosis in HeLa cells. The expected ED50 for this effect is 20-30 ng/ml.
Assay 2:
Determined by its ability to stimulate the proliferation of human TF-1 cells. The expected ED50 is ≤ 0.1 ng/ml, corresponding to a specific activity of ≥ 1 x 107 units/mg.
Hamster
None
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit