Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IL12B (P29460, 23 a.a. - 328 a.a.) Partial Recombinant Protein with His tag

Used for Func, SDS-PAGE, WB

Manufacturer:  Abnova™ P5377

Catalog No. 89-948-628

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children. [provided by RefSeq]

Sequence: HHHHHHIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Specifications

Specifications

P29460
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis, Western Blot
Lyophilized
35.5kDa
Non-transgenic plants (Nicotiana benthamiana) expression system
>97% by SDS-PAGE
10 ug
Store at -20°C on dry atmosphere. After reconstitution with sterilized water containing 0.1% HSA or BSA to a concentration of 50 ng/ul, store at -20°C. Aliquot to avoid repeated freezing and thawing.
<0.04 EU/μg protein
IL12B
The biological activity of IL12 p40 is determined by the dose dependent inhibition of IL-12 dependent IFN-gamma production (mouse splenocytes).
Yes
Non-transgenic plants (Nicotiana benthamiana) expression system
Lyophilized
3593
IL12B (Human) Recombinant Protein
Sequential chromatography (FPLC)
0.3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue
HHHHHHIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
RUO
CLMF|CLMF2|IL-12B|NKSF|NKSF2
IL12B
Plants
His
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit