Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IL17B (Q9UHF5) Partial Recombinant Protein

Used for Func, SDS-PAGE

Manufacturer:  Abnova™ P6092

Catalog No. 89-948-687


Add to cart

Description

Description

The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. [provided by RefSeq]

Sequence: MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
Specifications

Specifications

Q9UHF5
Functional Study, Sodium Dodecyl Sulfate–Polyacrylamide Gel Electrophoresis
Lyophilized
36.6kDa
E. coli expression system
25 ug
Store at -20°C. Reconstitute in water to a concentration of 0.1-1.0 mg/mL. Do not vortex. For extended storage, it is recommended to be further diluted in buffer containing carrier protein (e.g. 0.1% BSA) and stored in aliquots at -20°C to -80°C.
<0.1ng/μg (<1 EU/μg)
IL17B
Determined by its ability to induce IL-8 with human PBMCs at the range of 10-100ng/ml.
Note: Results may vary with different PBMC donors.
Escherichia coli
None
E. coli expression system
Lyophilized
27190
IL17B (Human) Recombinant Protein
0.98
MQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
RUO
IL-17B|IL-20|MGC138900|MGC138901|ZCYTO7
IL17B
Human ;Human
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit