Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human IL17C Full-length ORF (NP_037410.1, 1 a.a. - 197 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00027189P01L

 View more versions of this product

Catalog No. 89-948-690

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells. [provided by RefSeq]

Sequence: MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV
Specifications

Specifications

wheat germ expression system
AP, Array, ELISA, WB-Re
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
48.2kDa
Glutathione Sepharose 4 Fast Flow
25μg
RUO
IL17C
Wheat Germ (in vitro)
GST Tag
NP_037410.1
Liquid
27189
Human IL17C Full-length ORF (NP_037410.1, 1 a.a. - 197 a.a.) Recombinant Protein with GST-tag at N-terminal
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at −80°C. Aliquot to avoid repeated freezing and thawing.
CX2, IL-17C, IL-21, MGC126884, MGC138401
IL17C
Yes
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit